PTH


SMILES None
InChIKey None
Sequence AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNFVSLGVQMAAREGSYQRPTKKEENVLVDGNSKSLGEGDKADVDVLVKAKSQ

Chemical properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight (Da)

Drug properties

Molecular type Peptide
Endogenous/Surrogate Endogenous
Approved drug No

Database connections


Bioactivities

Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
GLP-2 GLP2R Human Glucagon B1 pIC50 7.4 7.4 7.4 Guide to Pharmacology
GLP-2 GLP2R Human Glucagon B1 pEC50 7.51 7.51 7.51 ChEMBL