BAY 55-9837


SMILES None
InChIKey XALJYDFLMDKOLY-ZBLLYJRDSA-N
Sequence HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY

Chemical properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight (Da)

Drug properties

Molecular type Peptide
Endogenous/Surrogate Surrogate
Approved drug No

Database connections

Bioactivities

Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
NTS2 NTR2 Rat Neurotensin A pKi 7.48 7.48 7.48 ChEMBL
NTS2 NTR2 Human Neurotensin A pKi 8.17 8.17 8.17 Drug Central
H1 HRH1 Human Histamine A pKi 8.14 8.14 8.14 Drug Central
NTS2 NTR2 Human Neurotensin A pKi 6.8 6.8 6.8 Guide to Pharmacology
NTS2 NTR2 Rat Neurotensin A pKi 8.13 8.13 8.13 Drug Central
Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
NTS2 NTR2 Mouse Neurotensin A pIC50 8.4 8.55 8.7 Guide to Pharmacology
NTS2 NTR2 Rat Neurotensin A pIC50 8.0 8.0 8.0 Guide to Pharmacology
NTS2 NTR2 Rat Neurotensin A pEC50 7.55 7.55 7.55 ChEMBL
NTS2 NTR2 Mouse Neurotensin A pIC50 8.06 8.06 8.06 Drug Central