cytokine domain of tyrosyl tRNA synthetase (Human) [2682]



cytokine domain of tyrosyl tRNA synthetase (Human)


SMILES None
InChIKey None
Sequence PEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS

Chemical Properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Log P None
Molecular weight (Da) None

Database connections

Model (AF2) CXCR1

No bioactivity data available.

cytokine domain of tyrosyl tRNA synthetase (Human)


Drug properties

Molecular type Peptide
Physiological/Surrogate Endogenous
Approved drug No

Distribution across phases (no. indications)

Phase I 0
Phase II 0
Phase III 0
Phase IV 0

Database connections

Model (AF2) CXCR1

Compound is not listed as a drug.