Ligand Data

Ligand

id 3760
Name viral macrophage inflammatory protein-II
SMILES None
InChIKey JOEHPBQVSCDCHE-BKGQOYFSSA-N
Type peptide
Sequence LGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTA
External Links
Structure pdb 4RWS

Structure

Properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight


Bioactivity

Receptor Affinity (nM) Potency (nM)
GTP Uniprot Species Family Class Min Avg Max Min Avg Max