teriparatide


SMILES None
InChIKey OGBMKVWORPGQRR-UMXFMPSGSA-N
Sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Chemical properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight (Da)

Drug properties

Molecular type Peptide
Physiological/Surrogate Surrogate
Approved drug Yes

Database connections

Structure pdb 8HA0 8HAO 7VVL 7VVK 7VVN
Ligand site mutations PTH1 PTH2

Bioactivities

Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
PTH1 PTH1R Human Parathyroid hormone B1 pIC50 7.4 7.4 7.4 Guide to Pharmacology
PTH2 PTH2R Human Parathyroid hormone B1 pIC50 7.7 7.75 7.8 Guide to Pharmacology
PTH1 PTH1R Rat Parathyroid hormone B1 pIC50 8.1 8.4 8.7 Guide to Pharmacology
PTH2 PTH2R Rat Parathyroid hormone B1 pIC50 6.3 6.3 6.3 Guide to Pharmacology
PTH1 PTH1R Human Parathyroid hormone B1 pIC50 10.1 10.1 10.1 ChEMBL
PTH1 PTH1R Human Parathyroid hormone B1 pEC50 8.6 9.04 9.52 ChEMBL
PTH1 PTH1R Human Parathyroid hormone B1 pIC50 8.13 8.13 8.13 Drug Central
PTH2 PTH2R Human Parathyroid hormone B1 pIC50 8.11 8.11 8.11 Drug Central
PTH1 PTH1R Rat Parathyroid hormone B1 pIC50 8.06 8.06 8.06 Drug Central
PTH2 PTH2R Rat Parathyroid hormone B1 pIC50 8.2 8.2 8.2 Drug Central