Tuberoinfundibular peptide of 39 residues [511777]



Tuberoinfundibular peptide of 39 residues


SMILES None
InChIKey None
Sequence SLALADDAAFRERARLLAALERRHWLNSYMHKLL

Chemical Properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Log P None
Molecular weight (Da) None

Database connections

Structure pdb 7F16


No bioactivity data available.

Tuberoinfundibular peptide of 39 residues


Drug properties

Molecular type Peptide
Physiological/Surrogate Surrogate
Approved drug No

Distribution across phases (no. indications)

Phase I 0
Phase II 0
Phase III 0
Phase IV 0

Database connections

Structure pdb 7F16


Compound is not listed as a drug.