β-CGRP


SMILES None
InChIKey None
Sequence ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF

Chemical properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight (Da)

Drug properties

Molecular type Peptide
Endogenous/Surrogate Endogenous
Approved drug No

Database connections


Bioactivities

Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
P2Y1 P2RY1 Human P2Y A pKi 6.92 6.92 6.92 Guide to Pharmacology
P2Y14 P2Y14 Human P2Y A pKi 5.46 5.46 5.46 ChEMBL
P2Y1 P2RY1 Human P2Y A pKi 8.22 8.22 8.22 ChEMBL
Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
P2Y1 P2RY1 Human P2Y A pIC50 5.68 6.56 7.54 ChEMBL