gastric inhibitory polypeptide
SMILES | None |
InChIKey | None |
Sequence | YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ |
Chemical properties
Hydrogen bond acceptors | None |
Hydrogen bond donors | None |
Rotatable bonds | None |
Molecular weight (Da) |
Drug properties
Molecular type | Peptide |
Endogenous/Surrogate | Endogenous |
Approved drug | No |
Database connections
Bioactivities
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
mGlu5 | GRM5 | Rat | Metabotropic glutamate | C | pKi | 6.99 | 6.99 | 6.99 | Guide to Pharmacology |
mGlu5 | GRM5 | Rat | Metabotropic glutamate | C | pKi | 6.99 | 6.99 | 6.99 | ChEMBL |
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
mGlu5 | GRM5 | Rat | Metabotropic glutamate | C | pIC50 | 7.23 | 7.23 | 7.23 | Guide to Pharmacology |
mGlu5 | GRM5 | Rat | Metabotropic glutamate | C | pIC50 | 7.23 | 7.23 | 7.23 | ChEMBL |