ASIP [90-132 (L89Y)]


SMILES None
InChIKey None
Sequence YSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC

Chemical properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight (Da)

Drug properties

Molecular type Peptide
Endogenous/Surrogate Surrogate
Approved drug No

Database connections


Bioactivities

Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
κ OPRK Human Opioid A pEC50 9.8 9.8 9.8 Guide to Pharmacology
κ OPRK Mouse Opioid A pEC50 10.32 10.32 10.32 Guide to Pharmacology
κ OPRK Human Opioid A pEC50 9.8 9.8 9.8 ChEMBL
κ OPRK Mouse Opioid A pEC50 10.32 10.32 10.32 ChEMBL