ASIP [90-132 (L89Y)]


SMILES None
InChIKey None
Sequence YSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC

Chemical properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight (Da)

Drug properties

Molecular type Peptide
Endogenous/Surrogate Surrogate
Approved drug No

Database connections


Bioactivities

Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
GnRH1 GNRHR Human Gonadotrophin-releasing hormone A pKd 9.2 9.2 9.2 ChEMBL
GnRH1 GNRHR Human Gonadotrophin-releasing hormone A pKi 8.06 8.06 8.06 Drug Central
GnRH1 GNRHR Human Gonadotrophin-releasing hormone A pKi 8.77 8.77 8.77 Guide to Pharmacology
Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
GnRH1 GNRHR Human Gonadotrophin-releasing hormone A pIC50 8.06 8.83 9.24 ChEMBL