pancreatic polypeptide


SMILES None
InChIKey None
Sequence APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY

Chemical properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight (Da)

Drug properties

Molecular type Peptide
Endogenous/Surrogate Endogenous
Approved drug No

Database connections


Bioactivities

Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
5-HT1A 5HT1A Human 5-Hydroxytryptamine A pKi 7.4 7.4 7.4 Guide to Pharmacology
5-HT1D 5HT1D Human 5-Hydroxytryptamine A pKi 8.9 8.9 8.9 Guide to Pharmacology
5-HT1E 5HT1E Human 5-Hydroxytryptamine A pKi 7.2 7.2 7.2 Guide to Pharmacology
5-HT1F 5HT1F Human 5-Hydroxytryptamine A pKi 8.0 8.0 8.0 Guide to Pharmacology
5-HT1B 5HT1B Human 5-Hydroxytryptamine A pKd 8.07 8.07 8.07 Drug Central
5-HT1A 5HT1A Human 5-Hydroxytryptamine A pKi 8.13 8.13 8.13 Drug Central
5-HT1D 5HT1D Human 5-Hydroxytryptamine A pKd 8.04 8.04 8.04 Drug Central
5-HT1E 5HT1E Human 5-Hydroxytryptamine A pKi 8.14 8.14 8.14 Drug Central
5-HT1F 5HT1F Human 5-Hydroxytryptamine A pKi 8.1 8.1 8.1 Drug Central
5-HT1B 5HT1B Human 5-Hydroxytryptamine A pKi 8.0 8.0 8.0 Guide to Pharmacology
Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
5-HT1B 5HT1B Human 5-Hydroxytryptamine A pEC50 7.93 7.93 7.93 ChEMBL