MIT1
SMILES | None |
InChIKey | None |
Sequence | AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSKS |
Chemical properties
Hydrogen bond acceptors | None |
Hydrogen bond donors | None |
Rotatable bonds | None |
Molecular weight (Da) |
Drug properties
Molecular type | Peptide |
Endogenous/Surrogate | Surrogate |
Approved drug | No |
Database connections
Bioactivities
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
PKR1 | PKR1 | Human | Prokineticin | A | pIC50 | 8.4 | 8.4 | 8.4 | Guide to Pharmacology |
PKR2 | PKR2 | Human | Prokineticin | A | pIC50 | 9.2 | 9.2 | 9.2 | Guide to Pharmacology |