prokineticin-2


SMILES None
InChIKey None
Sequence AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK

Chemical properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight (Da)

Drug properties

Molecular type Peptide
Endogenous/Surrogate Endogenous
Approved drug No

Database connections

Bioactivities

Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
5-HT2C 5HT2C Human 5-Hydroxytryptamine A pKi 6.6 6.6 6.6 Guide to Pharmacology
5-HT6 5HT6R Human 5-Hydroxytryptamine A pKi 9.08 9.08 9.08 Guide to Pharmacology
5-HT6 5HT6R Rat 5-Hydroxytryptamine A pKi 9.08 9.08 9.08 ChEMBL
5-HT7 5HT7R Human 5-Hydroxytryptamine A pKi 5.06 5.06 5.06 ChEMBL
5-HT6 5HT6R Human 5-Hydroxytryptamine A pKi 8.16 8.86 9.08 ChEMBL
5-HT2A 5HT2A Human 5-Hydroxytryptamine A pKi 6.1 6.1 6.1 ChEMBL
D2 DRD2 Human Dopamine A pKi 5.92 5.92 5.92 ChEMBL
5-HT1A 5HT1A Human 5-Hydroxytryptamine A pKi 5.41 5.41 5.41 ChEMBL
5-HT2C 5HT2C Human 5-Hydroxytryptamine A pKi 6.6 6.6 6.6 ChEMBL
Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
5-HT6 5HT6R Human 5-Hydroxytryptamine A pIC50 6.0 6.0 6.0 ChEMBL