GHRH
SMILES | None |
InChIKey | None |
Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL |
Chemical properties
Hydrogen bond acceptors | None |
Hydrogen bond donors | None |
Rotatable bonds | None |
Molecular weight (Da) |
Drug properties
Molecular type | Peptide |
Endogenous/Surrogate | Endogenous |
Approved drug | No |
Database connections
Ligand site mutations | GHRH |
Bioactivities
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
β1 | ADRB1 | Human | Adrenoceptors | A | pKi | 8.4 | 8.4 | 8.4 | Guide to Pharmacology |
β2 | ADRB2 | Human | Adrenoceptors | A | pKi | 9.26 | 9.26 | 9.26 | Guide to Pharmacology |
β3 | ADRB3 | Human | Adrenoceptors | A | pKi | 6.8 | 6.8 | 6.8 | Guide to Pharmacology |
β3 | ADRB3 | Mouse | Adrenoceptors | A | pKi | 6.2 | 6.25 | 6.3 | Guide to Pharmacology |
β3 | ADRB3 | Rat | Adrenoceptors | A | pKi | 6.4 | 6.4 | 6.4 | Guide to Pharmacology |
β1 | ADRB1 | Human | Adrenoceptors | A | pKi | 8.4 | 8.4 | 8.4 | ChEMBL |
β3 | ADRB3 | Human | Adrenoceptors | A | pKi | 6.59 | 6.59 | 6.59 | ChEMBL |
5-HT1A | 5HT1A | Rat | 5-Hydroxytryptamine | A | pKi | 5.78 | 5.78 | 5.78 | ChEMBL |
β2 | ADRB2 | Human | Adrenoceptors | A | pKi | 9.26 | 9.26 | 9.26 | ChEMBL |
β1 | ADRB1 | Human | Adrenoceptors | A | pKi | 8.08 | 8.08 | 8.08 | Drug Central |
5-HT1A | 5HT1A | Human | 5-Hydroxytryptamine | A | pKi | 8.24 | 8.24 | 8.24 | Drug Central |
β2 | ADRB2 | Human | Adrenoceptors | A | pKi | 8.03 | 8.03 | 8.03 | Drug Central |
β3 | ADRB3 | Human | Adrenoceptors | A | pKi | 8.18 | 8.18 | 8.18 | Drug Central |
β3 | ADRB3 | Mouse | Adrenoceptors | A | pKi | 8.2 | 8.2 | 8.2 | Drug Central |
β3 | ADRB3 | Rat | Adrenoceptors | A | pKi | 8.19 | 8.19 | 8.19 | Drug Central |
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
β1 | ADRB1 | Human | Adrenoceptors | A | pIC50 | 8.16 | 8.16 | 8.16 | ChEMBL |
β3 | ADRB3 | Human | Adrenoceptors | A | pIC50 | 6.47 | 6.47 | 6.47 | ChEMBL |
5-HT1A | 5HT1A | Rat | 5-Hydroxytryptamine | A | pIC50 | 5.54 | 5.54 | 5.54 | ChEMBL |
β2 | ADRB2 | Human | Adrenoceptors | A | pIC50 | 9.1 | 9.1 | 9.1 | ChEMBL |
5-HT1A | 5HT1A | Rat | 5-Hydroxytryptamine | A | pIC50 | 8.26 | 8.26 | 8.26 | Drug Central |
TSH | TSHR | Human | Glycoprotein hormone | A | Potency | 5.1 | 5.1 | 5.1 | ChEMBL |