GHRH
SMILES | None |
InChIKey | None |
Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL |
Chemical properties
Hydrogen bond acceptors | None |
Hydrogen bond donors | None |
Rotatable bonds | None |
Molecular weight (Da) |
Drug properties
Molecular type | Peptide |
Endogenous/Surrogate | Endogenous |
Approved drug | No |
Database connections
Ligand site mutations | GHRH |
Bioactivities
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
δ | OPRD | Human | Opioid | A | pKi | 6.81 | 6.81 | 6.81 | Guide to Pharmacology |
κ | OPRK | Human | Opioid | A | pKi | 9.09 | 9.09 | 9.09 | Guide to Pharmacology |
μ | OPRM | Human | Opioid | A | pKi | 7.62 | 7.62 | 7.62 | Guide to Pharmacology |
δ | OPRD | Human | Opioid | A | pKi | 6.78 | 6.85 | 6.91 | ChEMBL |
μ | OPRM | Human | Opioid | A | pKi | 7.64 | 7.71 | 7.79 | ChEMBL |
κ | OPRK | Human | Opioid | A | pKi | 9.02 | 9.11 | 9.22 | ChEMBL |
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
κ | OPRK | Human | Opioid | A | pKB | 9.09 | 9.09 | 9.09 | Guide to Pharmacology |