CHIPS


SMILES None
InChIKey None
Sequence FTFEPFPTNEEIESNKKMLEKEKAYKESFKNSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY

Chemical properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight (Da)

Drug properties

Molecular type Peptide
Endogenous/Surrogate Surrogate
Approved drug No

Database connections


Bioactivities

Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
P2Y2 P2RY2 Human P2Y A pEC50 8.1 8.1 8.1 Guide to Pharmacology
P2Y4 P2RY4 Human P2Y A pEC50 6.3 6.3 6.3 Guide to Pharmacology
P2Y6 P2RY6 Human P2Y A pEC50 5.2 5.2 5.2 Guide to Pharmacology
P2Y4 P2RY4 Rat P2Y A pEC50 5.6 5.6 5.6 Guide to Pharmacology
P2Y4 P2RY4 Rat P2Y A pEC50 5.58 5.58 5.58 ChEMBL
P2Y2 P2RY2 Rat P2Y A pEC50 6.89 6.89 6.89 ChEMBL
P2Y2 P2RY2 Mouse P2Y A pIC50 5.82 5.82 5.82 ChEMBL
P2Y2 P2RY2 Mouse P2Y A pEC50 5.9 5.9 5.9 ChEMBL
P2Y4 P2RY4 Human P2Y A pEC50 5.6 6.79 7.41 ChEMBL
P2Y6 P2RY6 Human P2Y A pEC50 5.22 5.6 6.37 ChEMBL
P2Y2 P2RY2 Human P2Y A pEC50 4.69 6.93 8.25 ChEMBL
P2Y4 P2RY4 Human P2Y A pEC50 8.2 8.2 8.2 Drug Central
P2Y6 P2RY6 Human P2Y A pEC50 8.28 8.28 8.28 Drug Central
P2Y11 P2Y11 Human P2Y A pEC50 8.28 8.28 8.28 Drug Central
P2Y4 P2RY4 Rat P2Y A pEC50 8.25 8.25 8.25 Drug Central
P2Y2 P2RY2 Human P2Y A pEC50 8.09 8.09 8.09 Drug Central
P2Y11 P2Y11 Human P2Y A pEC50 5.2 5.2 5.2 Guide to Pharmacology