cytokine domain of tyrosyl tRNA synthetase
cytokine domain of tyrosyl tRNA synthetase
| SMILES | None |
| InChIKey | None |
| Sequence | PEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS |
Chemical Properties
| Hydrogen bond acceptors | None |
| Hydrogen bond donors | None |
| Rotatable bonds | None |
| Molecular weight (Da) |
Database connections
No bioactivity data available.
cytokine domain of tyrosyl tRNA synthetase
Drug properties
| Molecular type | Peptide |
| Physiological/Surrogate | Endogenous |
| Approved drug | No |
Distribution across phases (no. indications)
Phase I
Phase II
Phase III
Phase IV