CCL24
SMILES | None |
InChIKey | None |
Sequence | VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC |
Chemical properties
Hydrogen bond acceptors | None |
Hydrogen bond donors | None |
Rotatable bonds | None |
Molecular weight (Da) |
Drug properties
Molecular type | Peptide |
Endogenous/Surrogate | Endogenous |
Approved drug | No |
Database connections
Bioactivities
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
P2Y12 | P2Y12 | Human | P2Y | A | pIC50 | 8.7 | 8.7 | 8.7 | Guide to Pharmacology |
P2Y13 | P2Y13 | Human | P2Y | A | pIC50 | 8.3 | 8.3 | 8.3 | Guide to Pharmacology |
GPR17 | GPR17 | Mouse | A orphans | A | pIC50 | 8.92 | 8.92 | 8.92 | Guide to Pharmacology |
P2Y12 | P2Y12 | Human | P2Y | A | pIC50 | 7.74 | 8.96 | 9.4 | ChEMBL |
P2Y12 | P2Y12 | Human | P2Y | A | pIC50 | 8.06 | 8.06 | 8.06 | Drug Central |
P2Y13 | P2Y13 | Human | P2Y | A | pIC50 | 8.08 | 8.08 | 8.08 | Drug Central |
GPR17 | GPR17 | Mouse | A orphans | A | pIC50 | 8.05 | 8.05 | 8.05 | Drug Central |
GPR17 | GPR17 | Human | A orphans | A | pIC50 | 9.15 | 9.15 | 9.15 | ChEMBL |