urotensin 1 (fish)
SMILES | None |
InChIKey | None |
Sequence | NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV |
Chemical properties
Hydrogen bond acceptors | None |
Hydrogen bond donors | None |
Rotatable bonds | None |
Molecular weight (Da) |
Drug properties
Molecular type | Peptide |
Physiological/Surrogate | Surrogate |
Approved drug | No |
Database connections
Bioactivities
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
CRF1 | CRFR1 | Human | Corticotropin-releasing factor | B1 | pKd | 7.8 | 8.6 | 9.4 | Guide to Pharmacology |
CRF2 | CRFR2 | Human | Corticotropin-releasing factor | B1 | pKd | 7.3 | 8.1 | 8.9 | Guide to Pharmacology |
CRF2 | CRFR2 | Mouse | Corticotropin-releasing factor | B1 | pKd | 8.5 | 8.5 | 8.5 | Guide to Pharmacology |
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |