helodermin
SMILES | None |
InChIKey | SSAAJZQUEUTACT-MDBKHZGBSA-N |
Sequence | HSDAIFTEEYSKLLAKLALQKYLASILGSRTSPPP |
Chemical properties
Hydrogen bond acceptors | None |
Hydrogen bond donors | None |
Rotatable bonds | None |
Molecular weight (Da) |
Drug properties
Molecular type | Peptide |
Physiological/Surrogate | Surrogate |
Approved drug | No |
Database connections
Bioactivities
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
VPAC1 | VIPR1 | Human | VIP and PACAP | B1 | pKi | 7.3 | 7.3 | 7.3 | Guide to Pharmacology |
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
VPAC2 | VIPR2 | Human | VIP and PACAP | B1 | pIC50 | 8.5 | 8.5 | 8.5 | Guide to Pharmacology |
VPAC1 | VIPR1 | Rat | VIP and PACAP | B1 | pIC50 | 8.1 | 8.1 | 8.1 | Guide to Pharmacology |
VPAC2 | VIPR2 | Rat | VIP and PACAP | B1 | pIC50 | 8.5 | 8.5 | 8.5 | Guide to Pharmacology |
VPAC1 | VIPR1 | Human | VIP and PACAP | B1 | pIC50 | 6.0 | 6.0 | 6.0 | Guide to Pharmacology |