agouti-related protein


SMILES None
InChIKey None
Sequence AQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

Chemical properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight (Da)

Drug properties

Molecular type Peptide
Physiological/Surrogate Endogenous
Approved drug No

Database connections

Ligand site mutations MC4

Bioactivities

Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
MC3 MC3R Human Melanocortin A pIC50 7.7 7.7 7.7 Guide to Pharmacology
MC4 MC4R Human Melanocortin A pIC50 9.3 9.3 9.3 Guide to Pharmacology
MC5 MC5R Human Melanocortin A pIC50 6.5 6.5 6.5 Guide to Pharmacology