PACAP-38
SMILES | None |
InChIKey | None |
Sequence | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK |
Chemical properties
Hydrogen bond acceptors | None |
Hydrogen bond donors | None |
Rotatable bonds | None |
Molecular weight (Da) |
Drug properties
Molecular type | Peptide |
Physiological/Surrogate | Endogenous |
Approved drug | No |
Database connections
Bioactivities
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
PAC1 | PACR | Human | VIP and PACAP | B1 | pKi | 8.233333333333334 | 8.23 | 8.23 | Guide to Pharmacology |
PAC1 | PACR | Rat | VIP and PACAP | B1 | pKi | 8.600000000000001 | 8.6 | 8.6 | Guide to Pharmacology |
VPAC1 | VIPR1 | Human | VIP and PACAP | B1 | pKi | 8.2 | 8.2 | 8.2 | Guide to Pharmacology |
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
PAC1 | PACR | Human | VIP and PACAP | B1 | pEC50 | 8.9 | 8.9 | 8.9 | Guide to Pharmacology |
PAC1 | PACR | Rat | VIP and PACAP | B1 | pEC50 | 9.833333333333334 | 9.83 | 9.83 | Guide to Pharmacology |
VPAC1 | VIPR1 | Human | VIP and PACAP | B1 | pEC50 | 8.55 | 8.55 | 8.55 | Guide to Pharmacology |
VPAC2 | VIPR2 | Human | VIP and PACAP | B1 | pEC50 | 8.5 | 8.5 | 8.5 | Guide to Pharmacology |