PHV
| SMILES | None |
| InChIKey | None |
| Sequence | HADGVFTSDYSRLLGQISAKKYLESLIGKRISSSISEDPVPV |
Chemical properties
| Hydrogen bond acceptors | None |
| Hydrogen bond donors | None |
| Rotatable bonds | None |
| Molecular weight (Da) |
Drug properties
| Molecular type | Peptide |
| Physiological/Surrogate | Endogenous |
| Approved drug | No |
Database connections
Bioactivities
| Receptor | Activity | Source | |||||||
|---|---|---|---|---|---|---|---|---|---|
| GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
| Receptor | Activity | Source | |||||||
|---|---|---|---|---|---|---|---|---|---|
| GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
| VPAC1 | VIPR1 | Human | VIP and PACAP | B1 | pIC50 | 5.5 | 5.5 | 5.5 | Guide to Pharmacology |
| VPAC1 | VIPR1 | Rat | VIP and PACAP | B1 | pIC50 | 8.5 | 8.5 | 8.5 | Guide to Pharmacology |
| VPAC2 | VIPR2 | Rat | VIP and PACAP | B1 | pIC50 | 8.2 | 8.2 | 8.2 | Guide to Pharmacology |
| VPAC2 | VIPR2 | Human | VIP and PACAP | B1 | pIC50 | 8.0 | 8.0 | 8.0 | Guide to Pharmacology |